PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.A00087.1.p
Common NameEUGRSUZ_A00087
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family FAR1
Protein Properties Length: 293aa    MW: 33250 Da    PI: 9.2699
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.A00087.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR185.77.2e-27127215290
              FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                       fY+eYA++vGF +r+ + ++s+r+g+i  r++ C+keg+  + + k    r++ra+tr gCka+++vk +++gkw++tk+++eHnH+l+
  Eucgr.A00087.1.p 127 FYDEYARRVGFVMRVMSCRRSERDGKILARRLGCNKEGYCVSIRGKFGPVRKPRASTREGCKAMIHVKVDRSGKWVITKFVKEHNHPLV 215
                       9**************************************99999998****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.2E-24127215IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MNRQRISKKL NRTNRAEEKP MTGHGEWADD DGPVRPNSRD WPDPSIAAHQ AALLVMAVLA  60
FCSSRHRSPT KRSIKSQPIR IEPMDLEDEA GAAENSGGVE LVDCEGDPIV EPCEGMEFDS  120
EDAAKIFYDE YARRVGFVMR VMSCRRSERD GKILARRLGC NKEGYCVSIR GKFGPVRKPR  180
ASTREGCKAM IHVKVDRSGK WVITKFVKEH NHPLVISPRE ARQTMDEKDK KIEESMAELR  240
NKKRLCAAYQ EQLTAFVKIV EEHNDQLSKK VESVVNNIRK YEPVNPGLMR RS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.A00087.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010064027.11e-166PREDICTED: uncharacterized protein LOC104450980
TrEMBLA0A059DBT80.0A0A059DBT8_EUCGR; Uncharacterized protein
STRINGGLYMA06G48170.31e-109(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM39182855
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.11e-106FAR1 family protein